Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Drums for sale
2 product(s) found for "Drums for sale"
8 inch Kette Repeater
Drums for sale
8 inch Kette Repeater
Introducing the 8-inch Kette Repeater Drum, a true masterpiece crafted with utmost precision and sustainability in mind. This exceptional drum is meticulously handmade using recycled Philippine mahogany...
£245.00
Units in Stock: 0
£245.00
Details
Add To Cart
Introducing the 8-inch Kette Repeater Drum, a true masterpiece crafted with utmost precision and sustainability in mind. This exceptional drum is meticulously handmade using recycled Philippine mahogany...
8 inch Kette Repeater
Drums for sale
8 inch Kette Repeater
Introducing the 8-inch Kette Repeater Drum, a true masterpiece crafted with utmost precision and sustainability in mind. This exceptional drum is meticulously handmade using recycled Philippine mahogany...
£245.00
Units in Stock: 0
£245.00
Details
Add To Cart
Introducing the 8-inch Kette Repeater Drum, a true masterpiece crafted with utmost precision and sustainability in mind. This exceptional drum is meticulously handmade using recycled Philippine mahogany...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i